{"product_id":"proteintech-25548-1-ap","title":"Proteintech, 25548-1-AP, ATRAID Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATRAID (25548-1-AP) by Proteintech is a Polyclonal antibody targeting ATRAID in WB, ELISA applications with reactivity to human,  mouse samples\n25548-1-AP targets ATRAID in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  HEK-293 cells,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATRAID, also named as APR3, p18, C2orf28, promotes osteoblast cell differentiation and terminal mineralization. It plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. This antibody recognizes all the three isoforms (20-24 kDa, 16-19 kDa and 28-30 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22168 Product name: Recombinant human C2orf28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC035850 Sequence: MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSF Predict reactive species\nFull Name: chromosome 2 open reading frame 28\nCalculated Molecular Weight: 229 aa, 25 kDa\nObserved Molecular Weight: 28-35 kDa\nGenBank Accession Number: BC035850\nGene Symbol: ATRAID\nGene ID (NCBI): 51374\nRRID: AB_2880128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UW56\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885137744041,"sku":"25548-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25548-1-ap","provider":"Iright","version":"1.0","type":"link"}