{"product_id":"proteintech-25590-1-ap","title":"Proteintech, 25590-1-AP, PRDM15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDM15 (25590-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM15 in WB, IP, ELISA applications with reactivity to human samples\n25590-1-AP targets PRDM15 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  Jurkat cells\nPositive IP detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe PR-domain containing proteins (PRDMs) have a common involvement in the modulation of gene activities. A PR-domain family member usually produces two products, called PR-plus and PR-minus, which differ by the presence or absence of the PR domain, respectively. The PR-plus product is underexpressed or disrupted in cancer cells, whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, which is a result of either genetic or epigenetic events, appears to be a determining factor of malignancy. PRDM15 (PR domain-containing protein 15), also known as PFM15 or ZNF298, is a 1507 amino acid protein belonging to the PRDM family. Localizing to the nucleus, PRDM15 contains sixteen C2H2-type zinc fingers and one SET domain. It is believed to participate in transcriptional regulation and may be involved in cell differentiation and tumorigenesis. PRDM15 exists several isoform and molecular weight of respective isoform is 169 kDa, 135kda, 62kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22296 Product name: Recombinant human PRDM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 791-1141 aa of BC067102 Sequence: KHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATFSEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPPQPQAPPQQAAQPQVQAEQQQQQMYSY Predict reactive species\nFull Name: PR domain containing 15\nCalculated Molecular Weight: 1507 aa, 169 kDa\nObserved Molecular Weight: 169 kDa\nGenBank Accession Number: BC067102\nGene Symbol: PRDM15\nGene ID (NCBI): 63977\nRRID: AB_2880145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57071\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869736226985,"sku":"25590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25590-1-ap","provider":"Iright","version":"1.0","type":"link"}