{"product_id":"proteintech-25592-1-ap","title":"Proteintech, 25592-1-AP, ZNF549 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF549 (25592-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF549 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n25592-1-AP targets ZNF549 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells,  A549 cells,  HeLa cells,  SMMC-7721 cells\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF549 (zinc finger protein 549), belonging to the kruppel C2H2-type zinc-finger protein family, is a 640 amino acid nuclear protein that exists as 2 alternatively spliced isoforms and may be involved in transcriptional regulation in cancer disease. Overexpression of ZNF549 inhibit the ability of COAD cell proliferation and migration (PMID: 33028966).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22371 Product name: Recombinant human ZNF549 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 109-236 aa of BC060863 Sequence: CILVMKDILYLSEHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTE Predict reactive species\nFull Name: zinc finger protein 549\nCalculated Molecular Weight: 640 aa, 74 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC060863\nGene Symbol: ZNF549\nGene ID (NCBI): 256051\nRRID: AB_2880147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P9A3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887949795497,"sku":"25592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25592-1-ap","provider":"Iright","version":"1.0","type":"link"}