{"product_id":"proteintech-25598-1-ap","title":"Proteintech, 25598-1-AP, NFU1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFU1 (25598-1-AP) by Proteintech is a Polyclonal antibody targeting NFU1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n25598-1-AP targets NFU1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue,  mouse brain tissue,  mouse testis tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFU1, also named as HIRA-interacting protein 5 or CGI-33, is a 254 amino acid protein, which belongs to the NifU family. NFU1 localizes in the Mitochondrion. NFU1 is widely expressed in adult tissues. NFU1, as an Iron-sulfur cluster scaffold protein, which can assemble clusters and deliver them to target proteins. It has an association with Multiple mitochondrial dysfunctions syndrome 1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22343 Product name: Recombinant human NFU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC113692 Sequence: MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP Predict reactive species\nFull Name: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae)\nCalculated Molecular Weight: 254 aa, 28 kDa\nObserved Molecular Weight: 23-28 kDa\nGenBank Accession Number: BC113692\nGene Symbol: NFU1\nGene ID (NCBI): 27247\nRRID: AB_2880151\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMS0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869566128297,"sku":"25598-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25598-1-ap","provider":"Iright","version":"1.0","type":"link"}