{"product_id":"proteintech-25655-1-ap","title":"Proteintech, 25655-1-AP, PAN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAN3 (25655-1-AP) by Proteintech is a Polyclonal antibody targeting PAN3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25655-1-AP targets PAN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nShortening of the poly(A) tail in mRNA, called deadenylation, is the first rate-limiting step in mRNA turnover. PAN3 is the regulatory subunit of a cytoplasmic poly(A) nuclease complex that links the catalytic PAN2 subunit to the poly(A)-binding protein PABP, which stimulates PAN2-dependent deadenylation activity (PMID: 14583602). PAN3 has four isoforms, isoform1: 95 kDa; isoform2: 64 kDa, isoform3: 89 kDa and isoform4: 72 kDa. This antibody recognizes isoform 1\/2\/3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22559 Product name: Recombinant human PAN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 512-687 aa of BC128180 Sequence: KAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL Predict reactive species\nFull Name: PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)\nCalculated Molecular Weight: 887 aa, 96 kDa\nObserved Molecular Weight: 90-100kDa; 65-68 kDa\nGenBank Accession Number: BC128180\nGene Symbol: PAN3\nGene ID (NCBI): 255967\nRRID: AB_3669491\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q58A45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887750238377,"sku":"25655-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25655-1-ap","provider":"Iright","version":"1.0","type":"link"}