{"product_id":"proteintech-25658-1-ap","title":"Proteintech, 25658-1-AP, DENND1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DENND1A (25658-1-AP) by Proteintech is a Polyclonal antibody targeting DENND1A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n25658-1-AP targets DENND1A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, A2780 cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDENND1A (DENN\/MADD domain containing 1A), also known as Connecdenn,FAM31A or KIAA1608, is a 1,009 amino acid peripheral membrane protein. Recent studies has found DENND1A is strongly associated with PCOS (Polycystic ovary syndrome). DENND1A has several isoforms.This antibody(25658-1-AP) can recognize all the isoforms at 112 kDa, 52-64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22547 Product name: Recombinant human DENND1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-559 aa of BC039703 Sequence: QKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPITVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPEQNTIATPATLHILQKSITHFAAKFPTRGWTSSSH Predict reactive species\nFull Name: DENN\/MADD domain containing 1A\nCalculated Molecular Weight: 1009 aa, 111 kDa\nObserved Molecular Weight: 111 kDa, 64 kDa\nGenBank Accession Number: BC039703\nGene Symbol: DENND1A\nGene ID (NCBI): 57706\nRRID: AB_2880180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEH3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887151861929,"sku":"25658-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25658-1-ap","provider":"Iright","version":"1.0","type":"link"}