{"product_id":"proteintech-25671-1-ap","title":"Proteintech, 25671-1-AP, CHCHD10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHCHD10 (25671-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD10 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications with reactivity to human, mouse, rat samples\n25671-1-AP targets CHCHD10 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  HAP1,  mouse heart tissue,  rat heart tissue\nPositive IP detected in: mouse heart tissue, HAP1 cells\nPositive IHC detected in: human kidney tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HAP1\nPositive CoIP detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nCo-Immunoprecipitation (CoIP): COIP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species\nFull Name: coiled-coil-helix-coiled-coil-helix domain containing 10\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC065232\nGene Symbol: CHCHD10\nGene ID (NCBI): 400916\nRRID: AB_2880187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WYQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868865482921,"sku":"25671-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25671-1-ap","provider":"Iright","version":"1.0","type":"link"}