{"product_id":"proteintech-25705-1-ap","title":"Proteintech, 25705-1-AP, ARMCX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARMCX3 (25705-1-AP) by Proteintech is a Polyclonal antibody targeting ARMCX3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25705-1-AP targets ARMCX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: fetal human brain\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARMCX3, also named as Armadillo repeat-containing X-linked protein 3, is a 379 amino acid protein, which contains 3 ARM repeats. ARMCX3 is a single pass membrane protein belonging to the armadillo repeat family of proteins. ARMCX3 is believed to play a role in embryonic development and tissue maintenance and may also function as a tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22501 Product name: Recombinant human ARMCX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-145 aa of BC005194 Sequence: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIA Predict reactive species\nFull Name: armadillo repeat containing, X-linked 3\nCalculated Molecular Weight: 379 aa, 43 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC005194\nGene Symbol: ARMCX3\nGene ID (NCBI): 51566\nRRID: AB_2880201\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UH62\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992884905,"sku":"25705-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25705-1-ap","provider":"Iright","version":"1.0","type":"link"}