{"product_id":"proteintech-25742-1-ap","title":"Proteintech, 25742-1-AP, ZMYM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZMYM3 (25742-1-AP) by Proteintech is a Polyclonal antibody targeting ZMYM3 in WB, IP, ELISA applications with reactivity to human, mouse samples\n25742-1-AP targets ZMYM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZMYM3, also named as DXS6673E, KIAA0385, and ZNF261, is a 1370 amino acid protein, which may be a component of a BHC histone deacetylase complex. ZMYM3 is most abundant in brain, moderate in muscle and heart, low in other tissues except placenta. ZMYM3 plays a role in the regulation of cell morphology and cytoskeletal organization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22701 Product name: Recombinant human ZMYM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-317 aa of BC013009 Sequence: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRAGRSAVGTKMTCAHCRTP Predict reactive species\nFull Name: zinc finger, MYM-type 3\nCalculated Molecular Weight: 1370 aa, 152 kDa\nObserved Molecular Weight: 190-200 kDa\nGenBank Accession Number: BC013009\nGene Symbol: ZMYM3\nGene ID (NCBI): 9203\nRRID: AB_2880221\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14202\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869795373225,"sku":"25742-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25742-1-ap","provider":"Iright","version":"1.0","type":"link"}