{"product_id":"proteintech-25779-1-ap","title":"Proteintech, 25779-1-AP, GRIK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRIK1 (25779-1-AP) by Proteintech is a Polyclonal antibody targeting GRIK1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25779-1-AP targets GRIK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, rat cerebellum tissue\nPositive IHC detected in: human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species\nFull Name: glutamate receptor, ionotropic, kainate 1\nCalculated Molecular Weight: 918 aa, 104 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC156975\nGene Symbol: GRIK1\nGene ID (NCBI): 2897\nRRID: AB_2880236\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P39086\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869463793833,"sku":"25779-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25779-1-ap","provider":"Iright","version":"1.0","type":"link"}