{"product_id":"proteintech-25781-1-ap","title":"Proteintech, 25781-1-AP, UQCC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UQCC2 (25781-1-AP) by Proteintech is a Polyclonal antibody targeting UQCC2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25781-1-AP targets UQCC2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human liver cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUQCC2, also named as C6orf125, MNF1, Mitochondrial protein M19 and Breast cancer-associated protein SGA-81M, plays a role in the modulation of respiratory chain activities. It's a mitochondrial protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22710 Product name: Recombinant human C6orf125 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC006007 Sequence: MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA Predict reactive species\nFull Name: chromosome 6 open reading frame 125\nCalculated Molecular Weight: 126 aa, 15 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC006007\nGene Symbol: UQCC2\nGene ID (NCBI): 84300\nRRID: AB_2880237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869507440809,"sku":"25781-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25781-1-ap","provider":"Iright","version":"1.0","type":"link"}