{"product_id":"proteintech-25797-1-ap","title":"Proteintech, 25797-1-AP, ZNF649 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF649 (25797-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF649 in WB, ELISA applications with reactivity to human, mouse samples\n25797-1-AP targets ZNF649 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF649, also named as Zinc finger protein 649, is a 505 amino acid protein, which contains The one KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family.\nZNF649 is highly expressed in heart, skeletal muscle, and brain and lower expression in liver, lung, kidney, pancreas and placenta. ZNF649 as a regulator of transcriptional factor complexes may suppress SRE and AP-1 transcription activities  by growth factor signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22700 Product name: Recombinant human ZNF649 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-183 aa of BC005368 Sequence: LWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDC Predict reactive species\nFull Name: zinc finger protein 649\nCalculated Molecular Weight: 505 aa, 58 kDa\nObserved Molecular Weight: 50-57 kDa\nGenBank Accession Number: BC005368\nGene Symbol: ZNF649\nGene ID (NCBI): 65251\nRRID: AB_2880241\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BS31\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887951925417,"sku":"25797-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25797-1-ap","provider":"Iright","version":"1.0","type":"link"}