{"product_id":"proteintech-25799-1-ap","title":"Proteintech, 25799-1-AP, PLA2G12B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLA2G12B (25799-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G12B in WB, ELISA applications with reactivity to human, mouse, rat samples\n25799-1-AP targets PLA2G12B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HepG2 cells,  HuH-7 cells,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhospholipase A2 (PLA2) enzymes catalyze hydrolysis of glycolipids to release free fatty acids and lysophospholipids. PLA2G12B is a secreted group XIIB secretory phospholipase A2-like protein belonging to the PLA2 family, but it is catalytically inactive due to an amino acid change in its active site and has altered phospholipid-binding properties (PMID: 14516201). It is located outside the cell membranes and strongly expressed in liver, small intestine and kidney, and recently reports revealed that Pla2g12b gene may be implicated in HDL cholesterol levels and metabolism (PMID: 22912808). The calculated molecular weight of PLA2G12B is 21 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22877 Product name: Recombinant human PLA2G12B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 115-195 aa of BC111946 Sequence: LDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL Predict reactive species\nFull Name: phospholipase A2, group XIIB\nCalculated Molecular Weight: 195 aa, 22 kDa\nObserved Molecular Weight: 21-22 kDa\nGenBank Accession Number: BC111946\nGene Symbol: PLA2G12B\nGene ID (NCBI): 84647\nRRID: AB_3085823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BX93\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887763771561,"sku":"25799-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25799-1-ap","provider":"Iright","version":"1.0","type":"link"}