{"product_id":"proteintech-25812-1-ap","title":"Proteintech, 25812-1-AP, A1CF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe A1CF (25812-1-AP) by Proteintech is a Polyclonal antibody targeting A1CF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25812-1-AP targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nA1CF, also known as Apobec-1 complementation factor, is an RNA-binding protein that plays a crucial role in the post-transcriptional editing of apolipoprotein B (apoB) mRNA. It is a component of the enzyme complex responsible for converting a CAA codon for glutamine to a UAA stop codon in apoB mRNA, resulting in the production of a truncated protein, apoB48, instead of the full-length apoB100.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species\nFull Name: APOBEC1 complementation factor\nCalculated Molecular Weight: 594 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC054873\nGene Symbol: A1CF\nGene ID (NCBI): 29974\nRRID: AB_3669501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629370537,"sku":"25812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25812-1-ap","provider":"Iright","version":"1.0","type":"link"}