{"product_id":"proteintech-25815-1-ap","title":"Proteintech, 25815-1-AP, SMCO4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMCO4 (25815-1-AP) by Proteintech is a Polyclonal antibody targeting SMCO4 in WB, IHC, ELISA applications with reactivity to human samples\n25815-1-AP targets SMCO4 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMCO4, also named as C11orf75 and FN5, is a Single-pass membrane and coiled-coil domain-containing protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22806 Product name: Recombinant human C11orf75 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-59 aa of BC031564 Sequence: MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE Predict reactive species\nFull Name: chromosome 11 open reading frame 75\nCalculated Molecular Weight: 59 aa, 7 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC031564\nGene Symbol: SMCO4\nGene ID (NCBI): 56935\nRRID: AB_2880249\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRQ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887809613993,"sku":"25815-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25815-1-ap","provider":"Iright","version":"1.0","type":"link"}