{"product_id":"proteintech-25821-1-ap","title":"Proteintech, 25821-1-AP, STK25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK25 (25821-1-AP) by Proteintech is a Polyclonal antibody targeting STK25 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n25821-1-AP targets STK25 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, HepG2 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22964 Product name: Recombinant human STK25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-426 aa of BC015793 Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR Predict reactive species\nFull Name: serine\/threonine kinase 25 (STE20 homolog, yeast)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC015793\nGene Symbol: STK25\nGene ID (NCBI): 10494\nRRID: AB_2880255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00506\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961132713,"sku":"25821-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25821-1-ap","provider":"Iright","version":"1.0","type":"link"}