{"product_id":"proteintech-25842-1-ap","title":"Proteintech, 25842-1-AP, ROR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROR2 (25842-1-AP) by Proteintech is a Polyclonal antibody targeting ROR2 in WB, ELISA applications with reactivity to human samples\n25842-1-AP targets ROR2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  T-47D cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR-family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22959 Product name: Recombinant human ROR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 781-943 aa of BC130522 Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA Predict reactive species\nFull Name: receptor tyrosine kinase-like orphan receptor 2\nCalculated Molecular Weight: 943 aa, 105 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC130522\nGene Symbol: ROR2\nGene ID (NCBI): 4920\nRRID: AB_2918094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01974\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887787626665,"sku":"25842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25842-1-ap","provider":"Iright","version":"1.0","type":"link"}