{"product_id":"proteintech-25887-1-ap","title":"Proteintech, 25887-1-AP, Chk1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Chk1 (25887-1-AP) by Proteintech is a Polyclonal antibody targeting Chk1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n25887-1-AP targets Chk1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  K-562 cells,  MCF-7 cells\nPositive IP detected in: HEK-293T cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293T cells\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHEK1(Checkpoint kinase-1) is also named as CHK1 and belongs to the protein kinase superfamily. It is implicated in a circuit in which it activates checkpoints, DNA repair and proliferating cell nuclear antigen and FANCD2 monoubiquitinylation(PMID:21389083). CHEK1 protects vertebrate cells against spontaneous chromosome missegregation and is required to sustain anaphase delay when spindle function is disrupted by taxol(PMID:17276342). It has 3 isoforms produced by alternative splicing with the molecular mass of 54 kDa, 44 kDa and 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22993 Product name: Recombinant human CHK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 262-476 aa of BC004202 Sequence: DRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT Predict reactive species\nFull Name: CHK1 checkpoint homolog (S. pombe)\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC004202\nGene Symbol: Chk1\nGene ID (NCBI): 1111\nRRID: AB_2880283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14757\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842381481,"sku":"25887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25887-1-ap","provider":"Iright","version":"1.0","type":"link"}