{"product_id":"proteintech-25897-1-ap","title":"Proteintech, 25897-1-AP, KIF5C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF5C (25897-1-AP) by Proteintech is a Polyclonal antibody targeting KIF5C in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25897-1-AP targets KIF5C in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF5C (Kinesin heavy chain isoform 5C variant) which belongs to the kinesin-like protein family is neuron specific. The kinesin-1 subfamilies (kif5a, kif5b, kif5c) are responsible for the movement of mitochondria in neurons. Kinesins have N-terminal motor domains and C-terminal cargo-binding tail domains separated by hinge regions. The hinge and C-terminal tail regions of Kif5a, Kif5b, and Kif5c bound a large detergent-resistant RNase-sensitive granule. The granule localized to dendrites and underwent bidirectional movement. Distally directed movement of the granule was enhanced by Kif5 overexpression and reduced by Kif5 functional blockage. kinesins may transport RNA in dendrites via this large granule. Two major isoforms of kif5c, with molecular predicted masses of 80 and 110 kDa, are generated by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23163 Product name: Recombinant human KIF5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-194 aa of BC110287 Sequence: AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR Predict reactive species\nFull Name: kinesin family member 5C\nCalculated Molecular Weight: 725 aa, 83 kDa\nObserved Molecular Weight: 70 kDa, 110 kDa\nGenBank Accession Number: BC110287\nGene Symbol: KIF5C\nGene ID (NCBI): 3800\nRRID: AB_2880288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60282\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934459561,"sku":"25897-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25897-1-ap","provider":"Iright","version":"1.0","type":"link"}