{"product_id":"proteintech-25898-1-ap","title":"Proteintech, 25898-1-AP, CCR7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCR7 (25898-1-AP) by Proteintech is a Polyclonal antibody targeting CCR7 in WB, IHC, ELISA applications with reactivity to human, rat samples\n25898-1-AP targets CCR7 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, C6 cells,  K-562 cells,  T-47D cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-C chemokine receptor type 7 (CCR7), which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probably acts as a mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22941 Product name: Recombinant human CCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 279-378 aa of BC035343 Sequence: YNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP Predict reactive species\nFull Name: chemokine (C-C motif) receptor 7\nCalculated Molecular Weight: 378 aa, 43 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC035343\nGene Symbol: CCR7\nGene ID (NCBI): 1236\nRRID: AB_2880289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32248\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875772073,"sku":"25898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25898-1-ap","provider":"Iright","version":"1.0","type":"link"}