{"product_id":"proteintech-25899-1-ap","title":"Proteintech, 25899-1-AP, GABRR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GABRR1 (25899-1-AP) by Proteintech is a Polyclonal antibody targeting GABRR1 in WB, ELISA applications with reactivity to human,  mouse samples\n25899-1-AP targets GABRR1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGABRR1 is a member of a family of ligand-gated chloride channels that are the major inhibitory neurotransmitter receptors in the central nervous system. GABRR1 acts as a rho-1 receptor of GABA, the major inhibitory neurotransmitter in the vertebrate brain, may play a role in retinal neurotransmission. And then, GABRR1 is highly expressed in the retina and in a lesser extent in brain, lung and thymus.  There are 3 isoforms for GABRR1 produced by alternative splicing, with the molecular weights of 46 kDa, 53 kDa, 56 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23165 Product name: Recombinant human GABRR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-78 aa of BC130344 Sequence: RMHWPGREVHEMSKKGSRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDD Predict reactive species\nFull Name: gamma-aminobutyric acid (GABA) receptor, rho 1\nCalculated Molecular Weight: 479 aa, 56 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC130344\nGene Symbol: GABRR1\nGene ID (NCBI): 2569\nRRID: AB_2880290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24046\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869461958825,"sku":"25899-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25899-1-ap","provider":"Iright","version":"1.0","type":"link"}