{"product_id":"proteintech-25933-1-ap","title":"Proteintech, 25933-1-AP, PCP4L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCP4L1 (25933-1-AP) by Proteintech is a Polyclonal antibody targeting PCP4L1 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n25933-1-AP targets PCP4L1 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCP4L1 (Purkinje cell protein 4-like 1) is a small neuronal IQ motif protein closely related to the calmodulin-binding protein Pcp4\/PEP-19 (PMID: 22458599).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23061 Product name: Recombinant human PCP4L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC028905 Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS Predict reactive species\nFull Name: Purkinje cell protein 4 like 1\nCalculated Molecular Weight: 68 aa, 7 kDa\nObserved Molecular Weight: 8-15 kDa\nGenBank Accession Number: BC028905\nGene Symbol: PCP4L1\nGene ID (NCBI): 654790\nRRID: AB_2880301\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NKN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869480374441,"sku":"25933-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25933-1-ap","provider":"Iright","version":"1.0","type":"link"}