{"product_id":"proteintech-25997-1-ap","title":"Proteintech, 25997-1-AP, XBP-1U specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XBP-1U specific (25997-1-AP) by Proteintech is a Polyclonal antibody targeting XBP-1U specific in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n25997-1-AP targets XBP-1U specific in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat spleen tissue,  mouse spleen tissue\nPositive IHC detected in: human breast cancer tissue,  human colon cancer tissue,  human liver cancer tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nX-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa. This antibody 25997-1-AP specially recognizes isoform XBP-1U.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21714 Product name: Recombinant human XBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 167-261 aa of BC000938 Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Predict reactive species\nFull Name: X-box binding protein 1\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC000938\nGene Symbol: XBP1\nGene ID (NCBI): 7494\nRRID: AB_2880326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17861\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868845658281,"sku":"25997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25997-1-ap","provider":"Iright","version":"1.0","type":"link"}