{"product_id":"proteintech-26040-1-ap","title":"Proteintech, 26040-1-AP, C20orf20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C20orf20 (26040-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf20 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n26040-1-AP targets C20orf20 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  mouse testis tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC20orf20, also named as MRG\/MORF4L-binding protein or Up-regulated in colon cancer 4 (Urcc4), is a 204 amino acid protein, which belongs to the EAF7 family. C20orf20 localizes in the nucleus and is a Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. C20orf20 is modified through phosphorylation and acetylation, so the molecular weight of C20orf20 might be 25-30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22840 Product name: Recombinant human C20orf20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC014235 Sequence: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT Predict reactive species\nFull Name: chromosome 20 open reading frame 20\nCalculated Molecular Weight: 204 aa, 22 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC014235\nGene Symbol: C20orf20\nGene ID (NCBI): 55257\nRRID: AB_2880347\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NV56\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869447934121,"sku":"26040-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26040-1-ap","provider":"Iright","version":"1.0","type":"link"}