{"product_id":"proteintech-26054-1-ap","title":"Proteintech, 26054-1-AP, TSEN15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSEN15 (26054-1-AP) by Proteintech is a Polyclonal antibody targeting TSEN15 in WB, ELISA applications with reactivity to human samples\n26054-1-AP targets TSEN15 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSEN15 is the non-catalytic subunit of the tRNA-splicing endonuclease complex, which is a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini (PMID: 15109492, 27392077).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22082 Product name: Recombinant human TSEN15 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-171 aa of BC022030 Sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR Predict reactive species\nFull Name: tRNA splicing endonuclease 15 homolog (S. cerevisiae)\nCalculated Molecular Weight: 171 aa, 19 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC022030\nGene Symbol: TSEN15\nGene ID (NCBI): 116461\nRRID: AB_3669520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887840448681,"sku":"26054-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26054-1-ap","provider":"Iright","version":"1.0","type":"link"}