{"product_id":"proteintech-26082-1-ap","title":"Proteintech, 26082-1-AP, ENT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENT2 (26082-1-AP) by Proteintech is a Polyclonal antibody targeting ENT2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26082-1-AP targets ENT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC29A2 also known as ENT2, comprises 456 amino acids and shares 46% amino acid identity with ENT1. ENT2 is involved in the facilitative transport of nucleosides and nucleobases and maintains their cellular homeostasis. The predicted molecular weight of ENT2 is 50 kDa, while 45 kDa band may be observed due to the deglycosylation (PMID: 10722669)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23310 Product name: Recombinant human SLC29A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-321 aa of BC093634 Sequence: PHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSP Predict reactive species\nFull Name: solute carrier family 29 (nucleoside transporters), member 2\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC093634\nGene Symbol: SLC29A2\nGene ID (NCBI): 3177\nRRID: AB_3669522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887552647337,"sku":"26082-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26082-1-ap","provider":"Iright","version":"1.0","type":"link"}