{"product_id":"proteintech-26150-1-ap","title":"Proteintech, 26150-1-AP, NBCe2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NBCe2 (26150-1-AP) by Proteintech is a Polyclonal antibody targeting NBCe2 in IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse samples\n26150-1-AP targets NBCe2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNBCe2, also named as SLC4A5 and NBC4, belongs to the anion exchanger (TC 2.A.31) family. NBCe2 mediates electrogenic Na+:HCO3 − transport, and can operate in both a 1:2, and 1:3 manner, but the transport stoichiometry as well as directionality have not been defined for the renal NBCe2. The expression of NBCe2 has been reported in nearly all kidney nephron segments and CDs, indicating that some species-specificity might be present (PMID: 32547422). NBCe2 has 8 isoforms with the molecular mass of 108-127 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23558 Product name: Recombinant human SLC4A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 953-1019 aa of BC109221 Sequence: NILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL Predict reactive species\nFull Name: solute carrier family 4, sodium bicarbonate cotransporter, member 5\nObserved Molecular Weight: 108-127 kDa\nGenBank Accession Number: BC109221\nGene Symbol: SLC4A5\nGene ID (NCBI): 57835\nRRID: AB_2918099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BY07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869564686505,"sku":"26150-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26150-1-ap","provider":"Iright","version":"1.0","type":"link"}