{"product_id":"proteintech-26157-1-ap","title":"Proteintech, 26157-1-AP, VEGFA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEGFA (26157-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFA in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n26157-1-AP targets VEGFA in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVegfa is a member of the PDGF\/VEGF growth factor family. It is a mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis, endothelial cell growth, promoting cell migration, and inhibiting apoptosis.It binds to the FLT1\/VEGFR1 and KDR\/VEGFR2 receptors, heparan sulfate and heparin. It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24084 Product name: Recombinant mouse Vegfa protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-214 aa of NM_001287056 Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Predict reactive species\nFull Name: vascular endothelial growth factor A\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_001287056\nGene Symbol: Vegfa\nGene ID (NCBI): 22339\nRRID: AB_2880408\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868866826409,"sku":"26157-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26157-1-ap","provider":"Iright","version":"1.0","type":"link"}