{"product_id":"proteintech-26201-1-ap","title":"Proteintech, 26201-1-AP, Unc119b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Unc119b (26201-1-AP) by Proteintech is a Polyclonal antibody targeting Unc119b in WB, IF\/ICC, ELISA applications with reactivity to human,  mouse,  Canine samples\n26201-1-AP targets Unc119b in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with human,  mouse,  Canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MDCK cells,  mouse kidney tissue,  HEK-293 cells,  HeLa cells\nPositive IF\/ICC detected in: MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMouse Unc119b is related closely to Unc119, a homolog of C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. Mouse Unc119b shares 90% sequence identity with human UNC119b protein. UNC119b is a myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Myristoyl-binding activity of UNC119b is required to localize NPHP3 to the primary cilium (PMID: 22085962).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, Canine\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24599 Product name: Recombinant mouse Unc119b protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC008617 Sequence: MSGSNPKAATAGSQAGPGGLVAGKEEKKKAGGGVLNRLKARRQGPPHTPDDGSGAAVTEQELLALDTIRPEHVLRLNRVTENYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCISDQDQDAEEESVDVDISVGRFVRYQFTPAFLRLRTVGATVEFTVGDRPVTGFRMIERHYFRERLLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLVMHNKADYAYNGGQ Predict reactive species\nFull Name: unc-119 homolog B (C. elegans)\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-31 kDa\nGenBank Accession Number: BC008617\nGene Symbol: Unc119b\nGene ID (NCBI): 106840\nRRID: AB_2880422\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8C4B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869785215145,"sku":"26201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26201-1-ap","provider":"Iright","version":"1.0","type":"link"}