{"product_id":"proteintech-26216-1-ap","title":"Proteintech, 26216-1-AP, ZNF202 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF202 (26216-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF202 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26216-1-AP targets ZNF202 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, human testis tissue,  mouse spermatophore tissue,  HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF202 gene product is a transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), and several genes involved in processes related to energy metabolism and vascular disease (PMID: 10748193). ZNF202 is expressed in two common splice variants. The α protein consists of 424 amino acids, while the β-protein consists of 648 amino acids (PMID: 11279031).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23859 Product name: Recombinant human ZNF202 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-416 aa of BC013382 Sequence: FKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHL Predict reactive species\nFull Name: zinc finger protein 202\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC013382\nGene Symbol: ZNF202\nGene ID (NCBI): 7753\nRRID: AB_3669529\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95125\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887940685993,"sku":"26216-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26216-1-ap","provider":"Iright","version":"1.0","type":"link"}