{"product_id":"proteintech-26256-1-ap","title":"Proteintech, 26256-1-AP, PUM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PUM1 (26256-1-AP) by Proteintech is a Polyclonal antibody targeting PUM1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n26256-1-AP targets PUM1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPUM1, also named as Pumilio homolog 1, is a 1186 amino acid protein, which is expressed in brain, heart, kidney, muscle, intestine and stomach. PUM1 as sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. PUM1 binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE). The calculated molecular weight of PUM1 is 126 kDa, but the modified PUM1 is about 130-140 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24651 Product name: Recombinant human PUM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC013398 Sequence: MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL Predict reactive species\nFull Name: pumilio homolog 1 (Drosophila)\nCalculated Molecular Weight: 1186 aa, 126 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC013398\nGene Symbol: PUM1\nGene ID (NCBI): 9698\nRRID: AB_2880448\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14671\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869578678441,"sku":"26256-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26256-1-ap","provider":"Iright","version":"1.0","type":"link"}