{"product_id":"proteintech-26272-1-ap","title":"Proteintech, 26272-1-AP, FGF-21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF-21 (26272-1-AP) by Proteintech is a Polyclonal antibody targeting FGF-21 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n26272-1-AP targets FGF-21 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor 21 (FGF21), a member of the FGF superfamily, has emerged as an important metabolic regulator. FGF21 is produced in the liver, adipocytes and skeletal muscle and regulates glucose, energy and lipid metabolism. FGF21 is a stress-responsive hepatokine which is induced in the liver as a response to injury, regeneration, hepatocarcinogenesis and during kidney dysfunction. FGF21 is primarily metabolized in the kidney and renal secretion is the major route of FGF21 elimination. Its plasma levels increase according to the decline in renal function in patients with chronic and acute renal dysfunction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24064 Product name: Recombinant human FGF21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-209 aa of BC018404 Sequence: HLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Predict reactive species\nFull Name: fibroblast growth factor 21\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: BC018404\nGene Symbol: FGF21\nGene ID (NCBI): 26291\nRRID: AB_2880455\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NSA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406384297,"sku":"26272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26272-1-ap","provider":"Iright","version":"1.0","type":"link"}