{"product_id":"proteintech-26332-1-ap","title":"Proteintech, 26332-1-AP, AE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AE2 (26332-1-AP) by Proteintech is a Polyclonal antibody targeting AE2 in WB, IHC, ELISA applications with reactivity to human samples\n26332-1-AP targets AE2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC4A2, also named as AE2, encodes a Cl-\/HCO3- exchanger. It has been reported that the reduced expression of SLC4A2 found in the liver and peripheral blood mononuclear cells of patients may be associated with the hypermethylation of SLC4A2 promoter regions, which might contribute to the pathogenesis of primary biliary cholangitis (PBC). 26332-1-AP antibody detects 150 kDa and 70 kDa (XP_006716157, 666aa) protein in SDS-PAGE. (PMID: 23341620, 32039364)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23673 Product name: Recombinant human SLC4A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC028601 Sequence: MSSAPRRPAKGADSFCTPEPGRKPRRRPGASPTGETPTIEEGEEDEDEASEAEGARALTQPSPVSTPSSVQFFLQEDDSADRKAERTSPSSPAPLPHQEATPRASKGAQAGTQVEEAEAEAVAVASGTAGGDDGGASGRHLPKAQPGHRSYNLQERRRIGSMTGAEQALL Predict reactive species\nFull Name: solute carrier family 4, anion exchanger, member 2 (erythrocyte membrane protein band 3-like 1)\nCalculated Molecular Weight: 1241 aa, 137 kDa\nObserved Molecular Weight: 150 and 70 kDa\nGenBank Accession Number: BC028601\nGene Symbol: AE2\nGene ID (NCBI): 6522\nRRID: AB_2880481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04920\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869632319657,"sku":"26332-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26332-1-ap","provider":"Iright","version":"1.0","type":"link"}