{"product_id":"proteintech-26362-1-ap","title":"Proteintech, 26362-1-AP, POU5F2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POU5F2 (26362-1-AP) by Proteintech is a Polyclonal antibody targeting POU5F2 in WB, ELISA applications with reactivity to human samples\n26362-1-AP targets POU5F2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCCIT cell\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOU5F2, also named as POU domain, class 5, transcription factor 2m, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and 1 POU-specific domain and belongs to the POU transcription factor family. POU5F2 as a transcription factor, localizes in the nuclues and may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23803 Product name: Recombinant human POU5F2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC029532 Sequence: MDGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDISGILKELQQLAKELRQKRLSLGYSQ Predict reactive species\nFull Name: POU domain class 5, transcription factor 2\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC029532\nGene Symbol: POU5F2\nGene ID (NCBI): 134187\nRRID: AB_2880491\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N7G0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769112745,"sku":"26362-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26362-1-ap","provider":"Iright","version":"1.0","type":"link"}