{"product_id":"proteintech-26366-1-ap","title":"Proteintech, 26366-1-AP, PAR1\/Thrombin Receptor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAR1\/Thrombin Receptor (26366-1-AP) by Proteintech is a Polyclonal antibody targeting PAR1\/Thrombin Receptor in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26366-1-AP targets PAR1\/Thrombin Receptor in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, K-562 cells,  mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtease-activated receptor-1 (PAR1) is a G protein coupled receptor.PAR1 has a greater affinity for thrombin and mediates rapid Ca2+ mobilization and platelet activation. PAR1 has a calculated molecular weight of 47 kDa, but can be detected as 70 kDa after posttranslational modification.(PMID: 26822533)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, monkey, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24378 Product name: Recombinant human F2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-102 aa of BC051909 Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Predict reactive species\nFull Name: coagulation factor II (thrombin) receptor\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 70 kDa, 47 kDa\nGenBank Accession Number: BC051909\nGene Symbol: F2R\nGene ID (NCBI): 2149\nRRID: AB_2880492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25116\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421162665,"sku":"26366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26366-1-ap","provider":"Iright","version":"1.0","type":"link"}