{"product_id":"proteintech-26379-1-ap","title":"Proteintech, 26379-1-AP, SLC25A36 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A36 (26379-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A36 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26379-1-AP targets SLC25A36 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A36 is a pyrimidine nucleotide carrier that belongs to the solute carrier family 25 (SLC25). SLC25A36 transports cytosine and uracil (deoxy)nucleosides monophosphate, diphosphate, and triphosphate via uniporter and antiporter(PMID: 25320081). It plays an important role in maintaining mitochondrial biogenesis. Loss of SLC25A36 in mouse embryonic stem cells (mESCs) is associated with mtDNA loss and mitochondrial dysfunction(PMID: 31036718).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23894 Product name: Recombinant human SLC25A36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-184 aa of BC014064 Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY Predict reactive species\nFull Name: solute carrier family 25, member 36\nObserved Molecular Weight: 32-34 kDa\nGenBank Accession Number: BC014064\nGene Symbol: SLC25A36\nGene ID (NCBI): 55186\nRRID: AB_3669532\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CQ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804829865,"sku":"26379-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26379-1-ap","provider":"Iright","version":"1.0","type":"link"}