{"product_id":"proteintech-26384-1-ap","title":"Proteintech, 26384-1-AP, HOXB13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXB13 (26384-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26384-1-AP targets HOXB13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, PC-3 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe homeobox (HOX) is a specific and widely distributed DNA sequence characterizing genes that are responsive to HOX transcription factors. Homeobox B13 (HOXB13) is one of the numerous DNA-binding transcription factors of the HOX gene family that has been implicated in the development of normal prostate and cancer (PMID: 25825985).\nIn addition, high-level expression of HOXB13 is closely associated with tumor angiogenesis and poor prognosis of hepatocellular carcinoma(PMID: 25031711).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24757 Product name: Recombinant human HOXB13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC007092 Sequence: MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRH Predict reactive species\nFull Name: homeobox B13\nCalculated Molecular Weight: 284 aa, 31 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC007092\nGene Symbol: HOXB13\nGene ID (NCBI): 10481\nRRID: AB_3085864\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92826\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670349993,"sku":"26384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26384-1-ap","provider":"Iright","version":"1.0","type":"link"}