{"product_id":"proteintech-26406-1-ap","title":"Proteintech, 26406-1-AP, WISP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WISP3 (26406-1-AP) by Proteintech is a Polyclonal antibody targeting WISP3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26406-1-AP targets WISP3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, COLO 320 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWISP3, also known as CCN6. Localized to the Mitochondria, and It is reported that CCN6 is located in the nucleus of breast cancer (PMID: 21262769). It is mainly expressed in adult kidney, testis and fetal kidney, and weakly expressed in placenta, ovary, prostate and small intestine (PMID: 9843955, PMID: 10471507). This gene is overexpressed in colon tumors, and it may be located downstream of WNT1 signaling pathway related to malignant transformation. Mutations of this gene are associated with progressive pseudorheumatoid dysplasia, an autosomal recessive skeletal disorder, indicating that the gene is essential for normal postnatal skeletal growth and cartilage homeostasis. Also it plays an important role in mitochondrial electron transfer and mitochondrial respiration, and may be important in bone growth and cartilage homeostasis after normal birth through its regulation of mitochondrial function (PMID: 27252383, PMID: 10471507). The calculated molecular weight of WISP3 is 39 kDa, and this antibody can recognize the 41 kDa isoform of WISP3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23999 Product name: Recombinant human WISP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-295 aa of BC105941 Sequence: ATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKA Predict reactive species\nFull Name: WNT1 inducible signaling pathway protein 3\nObserved Molecular Weight: 39-42 kDa\nGenBank Accession Number: BC105941\nGene Symbol: WISP3\nGene ID (NCBI): 8838\nRRID: AB_3085867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95389\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887923974313,"sku":"26406-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26406-1-ap","provider":"Iright","version":"1.0","type":"link"}