{"product_id":"proteintech-26407-1-ap","title":"Proteintech, 26407-1-AP, SLC5A6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC5A6 (26407-1-AP) by Proteintech is a Polyclonal antibody targeting SLC5A6 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n26407-1-AP targets SLC5A6 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse brain tissue,  mouse small intestine tissue,  COLO 320 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC5A6, also known as the sodium-dependent multivitamin transporter (hSMVT), is a transmembrane protein that plays a crucial role in the uptake of essential vitamins, including biotin, pantothenic acid, and lipoic acid. This protein is widely expressed in various human tissues, including the placenta, intestine, brain, liver, lung, kidney, cornea, retina, and heart. It uses energy from the transmembrane sodium ion gradient and membrane potential to actively transport these vitamins into cells. Due to different glycosylation modifications, SLC5A6 may exhibit two bands at ~55 kDa and ~69 kDa. (PMID: 20980265, PMID: 25971966)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23907 Product name: Recombinant human SLC5A6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 551-635 aa of BC012806 Sequence: RMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL Predict reactive species\nFull Name: solute carrier family 5 (sodium-dependent vitamin transporter), member 6\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC012806\nGene Symbol: SLC5A6\nGene ID (NCBI): 8884\nRRID: AB_2880502\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602828457,"sku":"26407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26407-1-ap","provider":"Iright","version":"1.0","type":"link"}