{"product_id":"proteintech-26413-1-ap","title":"Proteintech, 26413-1-AP, FAM92B\/CIBAR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe  FAM92B\/CIBAR2 (26413-1-AP) by Proteintech is a Polyclonal antibody targeting  FAM92B\/CIBAR2 in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n26413-1-AP targets  FAM92B\/CIBAR2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  COLO 320 cells,  mouse small intestine tissue\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM92B (family with sequence similarity 92, member B, also named CIBAR2) is a transmembrane protein that plays a crucial role in various cellular processes, including membrane trafficking and cell adhesion. The protein is predicted to be intracellular and is involved in ciliogenesis, likely through the recruitment and fusion of endosomal vesicles at distal appendages during early stages of ciliogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24802 Product name: Recombinant human FAM92B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-304 aa of BC111944 Sequence: VDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGGHLMLPGHSL Predict reactive species\nFull Name: family with sequence similarity 92, member B\nCalculated Molecular Weight: 304 aa, 35 kDa\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: BC111944\nGene Symbol: FAM92B\nGene ID (NCBI): 339145\nRRID: AB_2880506\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZTR7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869681799337,"sku":"26413-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26413-1-ap","provider":"Iright","version":"1.0","type":"link"}