{"product_id":"proteintech-26421-1-ap","title":"Proteintech, 26421-1-AP, ENAH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENAH (26421-1-AP) by Proteintech is a Polyclonal antibody targeting ENAH in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26421-1-AP targets ENAH in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, U-251 cells,  MCF-7 cells,  HUVEC cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24200 Product name: Recombinant human ENAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 501-577 aa of BC095481 Sequence: NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL Predict reactive species\nFull Name: enabled homolog (Drosophila)\nCalculated Molecular Weight: 591 aa, 67 kDa\nObserved Molecular Weight: 85-88 kDa, 75-80 kDa\nGenBank Accession Number: BC095481\nGene Symbol: ENAH\nGene ID (NCBI): 55740\nRRID: AB_2880509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N8S7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678555305,"sku":"26421-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26421-1-ap","provider":"Iright","version":"1.0","type":"link"}