{"product_id":"proteintech-26438-1-ap","title":"Proteintech, 26438-1-AP, 5HT2A Receptor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe 5HT2A Receptor (26438-1-AP) by Proteintech is a Polyclonal antibody targeting 5HT2A Receptor in IHC, ELISA applications with reactivity to human samples\n26438-1-AP targets 5HT2A Receptor in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 5HT2A Receptor gene (HTR2A) codes for a G-protein coupled receptor and belongs to the G-protein coupled receptor 1 family. HTR2A plays a key role in serotonin pathway regulation. HTR2A affects neural activity, perception, cognition, and mood and functions as the main target of atypical antipsychotic drugs (PMID: 17691947, 21550210). 5HT2A Receptor has 2 isoforms with the molecular mass of 44 and 53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24056 Product name: Recombinant human HTR2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 387-471 aa of BC074848 Sequence: YRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV Predict reactive species\nFull Name: 5-hydroxytryptamine (serotonin) receptor 2A\nCalculated Molecular Weight: 471 aa, 53 kDa\nGenBank Accession Number: BC074848\nGene Symbol: 5HT2A Receptor\nGene ID (NCBI): 3356\nRRID: AB_3085872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28223\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629305001,"sku":"26438-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26438-1-ap","provider":"Iright","version":"1.0","type":"link"}