{"product_id":"proteintech-26447-1-ap","title":"Proteintech, 26447-1-AP, SRMS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRMS (26447-1-AP) by Proteintech is a Polyclonal antibody targeting SRMS in IP, IHC, ELISA applications with reactivity to human samples\n26447-1-AP targets SRMS in IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HL-60 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24062 Product name: Recombinant human SRMS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-488 aa of BC153198 Sequence: EVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP Predict reactive species\nFull Name: src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites\nCalculated Molecular Weight: 488 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC153198\nGene Symbol: SRMS\nGene ID (NCBI): 6725\nRRID: AB_2880516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3Y6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887816528041,"sku":"26447-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26447-1-ap","provider":"Iright","version":"1.0","type":"link"}