{"product_id":"proteintech-26451-1-ap","title":"Proteintech, 26451-1-AP, TMEM160 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM160 (26451-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM160 in WB, IHC, ELISA applications with reactivity to human samples\n26451-1-AP targets TMEM160 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transmembrane protein (TMEM) family encompasses transmembrane proteins that traverse the lipid bilayer and wield critical functions across various cell types, encompassing inflammation and store-operated Ca2+ entry. TMEM160, a identified transmembrane protein that is localized in the mitochondrial membrane, has been implicated in neuropathic pain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24915 Product name: Recombinant human TMEM160 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002907 Sequence: MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHE Predict reactive species\nFull Name: transmembrane protein 160\nCalculated Molecular Weight: 188 aa, 20 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC002907\nGene Symbol: TMEM160\nGene ID (NCBI): 54958\nRRID: AB_3669535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX00\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830716585,"sku":"26451-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26451-1-ap","provider":"Iright","version":"1.0","type":"link"}