{"product_id":"proteintech-26460-1-ap","title":"Proteintech, 26460-1-AP, SFRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRP1 (26460-1-AP) by Proteintech is a Polyclonal antibody targeting SFRP1 in WB, IHC, IF\/ICC, IF-Fro, ELISA applications with reactivity to human, mouse samples\n26460-1-AP targets SFRP1 in WB, IHC, IF\/ICC, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NIH\/3T3 cells,  mouse kidney tissue,  rat kidney tissue,  SH-SY5Y cells,  U2OS cells,  mouse testis tissue\nPositive IHC detected in: human breast cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24844 Product name: Recombinant human SFRP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 164-250 aa of BC036503 Sequence: DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYL Predict reactive species\nFull Name: secreted frizzled-related protein 1\nCalculated Molecular Weight: 314 aa, 35 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC036503\nGene Symbol: SFRP1\nGene ID (NCBI): 6422\nRRID: AB_2880522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N474\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903788713,"sku":"26460-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26460-1-ap","provider":"Iright","version":"1.0","type":"link"}