{"product_id":"proteintech-26469-1-ap","title":"Proteintech, 26469-1-AP, Mitoferrin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mitoferrin 1 (26469-1-AP) by Proteintech is a Polyclonal antibody targeting Mitoferrin 1 in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, mouse liver tissue,  mouse spleen tissue,  rat spleen tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24876 Product name: Recombinant human SLC25A37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species\nFull Name: solute carrier family 25, member 37\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC132799\nGene Symbol: Mitoferrin 1\nGene ID (NCBI): 51312\nRRID: AB_2880527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876722345,"sku":"26469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26469-1-ap","provider":"Iright","version":"1.0","type":"link"}