{"product_id":"proteintech-26484-1-ap","title":"Proteintech, 26484-1-AP, GNB1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNB1L (26484-1-AP) by Proteintech is a Polyclonal antibody targeting GNB1L in WB, ELISA applications with reactivity to human samples\n26484-1-AP targets GNB1L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNB1L (G-protein subunit beta 1 like), located at 22q11.2, encodes a G-protein L-subunit-like polypeptide which is a member of the WD repeat protein family (PMID: 20538345). In humans, the hemizygous deletion of GNB1L can cause sensorimotor gating defects, which are related to schizophrenia and other serious mental diseases (PMID: 32847500). Moreover, GNB1L is a key regulator of DDR signaling via its role as a co-chaperone specifically regulating PIKK proteins (PMID: 37541219). GNB1L has 2 isoforms 36 kDa and 22 kDa, about 22 kDa which may be produced by Alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24391 Product name: Recombinant human GNB1L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 187-278 aa of BC012060 Sequence: DGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIR Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta polypeptide 1-like\nCalculated Molecular Weight: 327 aa, 36 kDa\nObserved Molecular Weight: 36 kDa, 18 kDa\nGenBank Accession Number: BC012060\nGene Symbol: GNB1L\nGene ID (NCBI): 54584\nRRID: AB_3085876\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYB4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653703849,"sku":"26484-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26484-1-ap","provider":"Iright","version":"1.0","type":"link"}