{"product_id":"proteintech-26496-1-ap","title":"Proteintech, 26496-1-AP, ZIP13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZIP13 (26496-1-AP) by Proteintech is a Polyclonal antibody targeting ZIP13 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26496-1-AP targets ZIP13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse skeletal muscle tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZIP13, a member of the SLC39A\/ZIP family, is mainly localized in the Golgi apparatus. It has been shown to play important roles in the development of bone, tooth and connective tissues. The apparent molecular weight of ZIP13 detected by SDS\/PAGE was lower than its expected molecular mass (32 kDa), likely because of the largely hydrophobic nature of the protein, its high capacity to bind SDS, and, therefore, its more rapid migration during gel electrophoresis (PMID: 23213233).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24388 Product name: Recombinant human SLC39A13 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-68 aa of BC008853 Sequence: MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALLSGERLDTW Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 13\nCalculated Molecular Weight: 371 aa, 39 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC008853\nGene Symbol: ZIP13\nGene ID (NCBI): 91252\nRRID: AB_3085877\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96H72\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887936983209,"sku":"26496-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26496-1-ap","provider":"Iright","version":"1.0","type":"link"}