{"product_id":"proteintech-26528-1-ap","title":"Proteintech, 26528-1-AP, BCAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCAM (26528-1-AP) by Proteintech is a Polyclonal antibody targeting BCAM in WB, ELISA applications with reactivity to human samples\n26528-1-AP targets BCAM in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HT-29 cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBasal cell adhesion molecule (Lu\/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran\/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens.  Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24753 Product name: Recombinant human BCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 569-628 aa of BC050450 Sequence: YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Predict reactive species\nFull Name: basal cell adhesion molecule (Lutheran blood group)\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 67 kDa, 78-85 kDa\nGenBank Accession Number: BC050450\nGene Symbol: BCAM\nGene ID (NCBI): 4059\nRRID: AB_3669545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50895\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869642248361,"sku":"26528-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26528-1-ap","provider":"Iright","version":"1.0","type":"link"}