{"product_id":"proteintech-26532-1-ap","title":"Proteintech, 26532-1-AP, PPM1D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1D (26532-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1D in WB, IF\/ICC, ELISA applications with reactivity to human,  mouse, Rat samples\n26532-1-AP targets PPM1D in WB, IF\/ICC, ELISA applications and shows reactivity with human,  mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse lung tissue,  rat testis tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+\/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, Rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24751 Product name: Recombinant human PPM1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-423 aa of BC060877 Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE Predict reactive species\nFull Name: protein phosphatase 1D magnesium-dependent, delta isoform\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC060877\nGene Symbol: PPM1D\nGene ID (NCBI): 8493\nRRID: AB_2880544\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869734293673,"sku":"26532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26532-1-ap","provider":"Iright","version":"1.0","type":"link"}